PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539415.1_FGP004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 334aa    MW: 37870.4 Da    PI: 4.7866
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539415.1_FGP004genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS111.11.5e-34194329236373
               GRAS 236 PkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpv 327
                        +k++ vv  +  ++++ F++rf eal +ysa fd+l+a++pr++++r  +Er +lgr + nv+acega+r+ r et+++W+ r ++aG+k++
  KN539415.1_FGP004 194 SKLMCVV--NGAYGAPFFVTRFREALFFYSAHFDMLDATIPRDKDDRLLIERDMLGRCALNVIACEGADRVDRPETYKQWQVRNHRAGLKQL 283
                        5555555..5678999**************************************************************************** PP

               GRAS 328 plsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                        pl+ ++++ ++  ++  + + + ++ ++++l++gWk+r L+++S W
  KN539415.1_FGP004 284 PLEAEVVELVRGKVKSLYHKDFVIDVDHNWLLQGWKGRILYAMSTW 329
                        ******************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098516.1531310IPR005202Transcription factor GRAS
PfamPF035145.3E-32194329IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MAAASKQEEL VVVVEQPFSP SLFLDLPPTP HQHHDDDPNN VNDDLLLPFI SRILMEDDID  60
DKFFYQFPDH PALLQAQQSY AQILHAPATS SSSDDTTINN NTTNSSDHDA DTQSQSAPDD  120
MEMLNMAFLK GREEATKFLP TNNTLFSDLK AEPVLDIQPT FMFGPSDGGG GRGRKNRHAE  180
LEEDHLEAET SRSSKLMCVV NGAYGAPFFV TRFREALFFY SAHFDMLDAT IPRDKDDRLL  240
IERDMLGRCA LNVIACEGAD RVDRPETYKQ WQVRNHRAGL KQLPLEAEVV ELVRGKVKSL  300
YHKDFVIDVD HNWLLQGWKG RILYAMSTWV SHHP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1370640.0AC137064.4 Oryza sativa Japonica Group cultivar Nipponbare chromosome 11 clone OSJNBb0003C04 map S10003, complete sequence.
GenBankAP0149670.0AP014967.1 Oryza sativa Japonica Group DNA, chromosome 11, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615829.12e-93PREDICTED: scarecrow-like protein 9
TrEMBLI1R2B12e-93I1R2B1_ORYGL; Uncharacterized protein
STRINGORGLA11G0190300.15e-93(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3741623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29065.13e-55GRAS family protein